정보

구성적으로 활성인 키나아제가 고도로 조절될 수 있습니까?

구성적으로 활성인 키나아제가 고도로 조절될 수 있습니까?



We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

저는 protein kinase GSK3를 연구하고 있으며 활성 조절에 대해 배우고 있습니다. 내가 읽은 많은 저널 논문은 GSK3가 구성적으로 활성인 키나제이기 때문에 독특하다고 언급했습니다. 특정 티로신 잔기에서 GSK3의 인산화가 활성을 향상시킬 뿐이지만 GSK3 자체는 항상 활성이라는 것을 읽었습니다.

그러나 이러한 많은 논문은 GSK3의 활성이 조절되는 다양한 메커니즘에 대해서도 이야기합니다(예: 특정 아미노산 잔기에서의 인산화, 세포 내 위치, 단백질 복합체 형성을 통해). 한 논문에서는 다음과 같이 기술합니다.

GSK3에 의해 조절되는 많은 기능(수많은 기질의 인산화를 통해)은 GSK3의 활성이 고도로 조절되어야 함을 시사합니다. 기질 특이적 방식으로 GSK3의 작용을 조절하는 데 기여하는 4가지 주요 메커니즘이 확인되었습니다. 여기에는 GSK3 자체의 인산화에 의한 조절, GSK3의 세포내 국소화, GSK3을 포함하는 단백질 복합체의 형성, GSK3 기질의 인산화 상태가 포함됩니다.

키나아제가 어떻게 구성적으로 활성이면서 동시에 고도로 조절될 수 있는지 궁금합니다. 그것이 구성적으로 활동적이라면 이것이 항상 활동적이라는 것을 의미하지 않습니까? 모든 통찰력에 감사드립니다.


나는 당신이 자신의 질문에 대답했다고 생각하지만 네, 명명법이 혼란스럽습니다. 그들이 그것이 구성적으로 활성인 키나아제라고 말할 때, 당신이 옳습니다. 그것은 효소가 항상 다른 분자/단백질을 인산화할 수 있다는 것을 의미합니다.

규제 부분은 인용한 리뷰 논문에 있는 내용입니다. 키나아제가 항상 켜져 있지만 인산화할 것이 없는 구획에 국한된 경우 "조절된" 것으로 간주될 수 있습니다. 나열된 다른 규제 방법에도 동일한 논리가 적용됩니다.


미토겐 활성화 단백질 키나아제/세포외 신호 조절 키나아제 키나아제(MEK) 의존적 전사 프로그램은 아미노산 제한 동안 초기 성장 반응 1(EGR1) 유전자의 활성화를 제어합니다

포유류 세포의 아미노산(AA) 제한은 AA 반응(AAR)이라고 하는 신호 캐스케이드의 집합을 촉발합니다. 인간 HepG2 간세포 암종에서 초기 성장 반응 1(EGR1) 유전자는 AA 박탈 또는 소포체 스트레스에 의해 유도되었습니다. AAR-의존성 EGR1 활성화는 잘 특성화된 GCN2-ATF4 경로와 무관하고 대신 MAPK 경로 중 하나인 MEK-ERK 신호전달에 의존하는 것으로 밝혀졌습니다. ChIP는 EGR1 근위 프로모터 영역에서 구성적으로 결합된 ELK1이 AAR 활성화 후에 인산화되었음을 보여주었다. 증가된 p-ELK1 결합은 EGR1 프로모터에 대한 RNA 중합효소 II의 증가된 신규 모집과 관련이 있었습니다. EGR1 전사는 내인성 MEK 활성이 결여된 HEK293T 세포에서 유도되지 않았지만, HEK293T 세포에서 외인성 구성적으로 활성인 MEK의 과발현은 기저 및 AAR-유도 EGR1 발현을 증가시켰다. 알려진 EGR1 반응성 유전자인 인간 혈관 내피 성장 인자 A(VEGF-A) 유전자의 ChIP 분석은 근위 프로모터 내의 AAR 유도 EGR1 결합의 적당한 증가와 첫 번째 인트론 내의 부위에 대한 고도의 유도성 결합을 밝혀냈습니다. 종합적으로, 이 데이터는 새로운 AA 활성화 MEK-ERK-ELK1 신호 메커니즘을 문서화합니다.

키워드: ATF4 아미노산 아미노산 반응 아스파라긴 합성 효소 유전자 전사 HepG2 세포 간세포 암종 Mitogen-activated protein Kinase (MAPK) 전사.

© 2014 미국 생화학 및 분자 생물학 학회, Inc.


소개

조절된 세포 이동은 면역 세포 기능, 조직 리모델링, 신경 발생 및 상처 치유를 포함한 다양한 생리학적 과정에 필요합니다. 세포 이동의 부적절한 조절은 종양 세포 침습 및 전이를 포함한 병리학적 과정에 기여할 수 있습니다. 세포 이동은 세포막의 지시된 돌출, 기질에 대한 막의 부착, 세포체의 수축 및 세포 후면의 분리를 포함하는 조정된 과정입니다(Lauffenburger and Horwitz, 1996). Rho GTPases Rac, Cdc42 및 Rho에 의한 액틴 세포 골격의 동적 재구성은 세포 운동성을 조정합니다(Ridley, 2001 Etienne-Manneville 및 Hall, 2002). Rac 및 Cdc42의 활성화는 Arp 2/3 복합체( Ma ., 1998 마체스키 ., 1999 로햇기 ., 1999 미키 ., 2000). Rac는 또한 초점 복합체로 알려진 세포막 돌출부의 팁에서 일시적인 초기 접착 부위의 형성을 촉진합니다(Nobes and Hall, 1999 Rottner ., 1999). Rho는 세포 수축성, 액틴 스트레스 섬유의 형성 및 초점 복합체를 초점 접착으로 알려진 더 크고 안정적인 접착 구조로 성숙시키는 것을 촉진합니다( Chrzanowska-Wodnicka 및 Burridge, 1996 Clark ., 1998 Nobes and Hall, 1999 Rottner ., 1999). 인테그린, 세포외 기질 단백질에 대한 막횡단 수용체, 단백질 키나제 src 및 FAK, 어댑터 단백질 팍실린, α 액티닌, 빈쿨린을 포함하여 인테그린과 단백질을 연결하는 50개 이상의 단백질이 국소 유착에 국한되는 것으로 나타났습니다. 액틴 세포골격에 대한 키나아제(가이거 ., 2001 Zamir 및 Geiger, 2001). 국소 유착은 세포외 기질, 인테그린 및 액틴 세포골격 사이의 연결 고리 역할을 할 뿐만 아니라 세포 성장 및 세포 사멸 반응의 조절에 중요한 신호 전달 센터로서 기능합니다.

최근에 p21 활성화 키나아제(PAK)1는 Rac 및 Cdc42를 활성화하고 세포 이동을 촉진하는 자극에 대한 반응으로 막 돌출부의 끝 부분에서 국소 복합체에 국한되는 것으로 나타났습니다(Dharmawardhane ., 1997년 판매 ., 2000). PAK 계열의 세린/트레오닌 키나제는 Rac 및 Cdc42의 중요한 이펙터입니다(Bokoch, 2003). PAK 1𠄳은 활성 Rac 및 Cdc42가 N-말단 조절 도메인에서 PAK 동종이량체에 결합하여 활성화됩니다( Parrini ., 2002). GTPase 결합은 PAK 키나제 도메인과 PAK 자가억제 도메인 사이의 억제 상호작용을 방해하여 PAK 인산화 및 활성화를 초래합니다( Zhao ., 1998 젠케 ., 1999). PAK1은 세포 이동을 조절하기 위해 액틴 및 미세소관 세포골격의 역학을 조절하는 것으로 나타났습니다. 구성적으로 활성화된 PAK1 돌연변이의 과발현은 액틴 스트레스 섬유의 용해 및 국소 접착을 유도하고 막 돌출, 세포 분극 및 세포 운동성을 증가시킵니다. ., 1997년 판매 ., 1997, 1999 프로스트 ., 1998). 반대로, 내피 세포에서 활성 PAK1의 과발현은 감소된 세포 이동 및 액틴 스트레스 섬유 및 국소 유착의 안정화를 초래합니다. ., 1999). 이러한 효과는 LIM 키나제(Edwards)와 같은 세포골격 조절 단백질에 대한 PAK의 작용을 통해 매개됩니다. ., 1999), 미오신 경쇄 키나제(Sanders) ., 1999), 필라민 A(바들라무디) ., 2002) 및 Op18/Stathmin(Daub ., 2001 비트만 ., 2003). 증가된 PAK 활성은 인간 유방암 세포주의 향상된 운동성 및 침습성과 상관관계가 있습니다( Vadlamudi ., 2000 ).

PAK1을 국소 접착 및 국소 복합체에 국한시키는 분자 메커니즘이 조사되기 시작했습니다. 키나아제-사멸 PAK1 또는 PAK1의 키나아제 도메인 절단 돌연변이의 이소성 발현은 야생형 또는 구성적으로 활성 PAK1이 아닌, HeLa 세포의 국소 유착에 대한 PAK의 국소화를 초래한다(Manser ., 1997). 야생형 PAK1은 PAK의 자가억제 도메인이 있는 상태에서 국소 유착에 국한됩니다( Zhao ., 2000a) 및 활성화된 형태의 Rac 또는 Cdc42 발현 시( Manser ., 1997), 자가억제 도메인으로 PAK를 비활성화하거나 활성 GTPase로 PAK 키나제를 활성화하는 것이 국소 접착 국소화를 유도할 수 있다는 명백히 모순된 결과를 초래합니다. 초점 접착 표적화에 필요한 PAK1 영역이 조사되었습니다. PAK1의 N 말단에는 어댑터 단백질 NCK( Bokoch ., 1996 갈리스테오 ., 1996) 및 Grb2(푸토 ., 2003) 및 구아닌 뉴클레오티드 교환 인자 PIX(Manser ., 1998). PIX와 NCK 모두 NCK-( Zhao ., 2000a) 또는 PIX-바인딩( Manser ., 1998) 프롤린이 풍부한 영역은 국소 유착에 국소화하는 이소성 발현 PAK1의 능력을 폐지했습니다. 최근에, 고도로 상동성인 ARF GAP 단백질 PKL( Turner ., 1999) 및 GIT1(Premont ., 1998) PAK를 초점 유착으로 표적화하는 데 중요한 역할을 합니다(Brown ., 2002 마나베 리 ., 2002). PKL과 GIT1은 국소 접착 단백질인 팍실린과 PAK 관련 PIX에 결합할 수 있는 어댑터 단백질 역할을 합니다( Turner ., 1999 자오 ., 2000b). 더 이상 PKL에 결합하지 않는 팍실린 돌연변이의 과발현은 PAK의 N 말단이 국소 접착에 국한되는 것을 방지했습니다. ., 2002 ).

이 연구에서 우리는 높은 수준의 활성화된 Rac1 또는 Cdc42가 없을 때 PAK1 및/또는 PAK2가 SK-BR-3 및 ZR-75-1 인간 유방암 세포주에서 구성적으로 활성화된다는 것을 보여줍니다. 또한, 내인성 활성화된 PAK는 구성적으로 크고 비정형적인 국소 접착 구조에 국한됩니다. Rho GTPase 또는 NCK가 아닌 PIX의 PAK에 대한 결합은 PAK를 이러한 국소 유착에 표적화합니다. 국소 접착에서 PAK의 변위는 구성적 PAK 활성을 무효화하고 이러한 팍실린 및 PIX 함유 접착 구조의 회전율을 증가시킵니다. 이러한 결과는 팍실린 함유 국소 유착의 유지에서 PAK/PIX 결합에 대한 예상치 못한 역할을 나타냅니다.


내용물

단백질 키나제는 뉴클레오사이드 삼인산(종종 ATP)에서 감마(말단) 인산염을 단백질 기질 측쇄에 있는 하나 이상의 아미노산 잔기로 전달하여 단백질 기능에 영향을 미치는 형태적 변화를 초래하는 촉매 소단위를 소유한 효소 그룹입니다. . 효소는 기질 특이성을 특징으로 하는 세린/트레오닌 특이적 및 티로신 특이적(이 기사의 주제)의 두 가지 광범위한 부류로 나뉩니다. [1]

키나아제는 ATP와 같은 뉴클레오사이드 삼인산 공여체에서 수용체 분자로 인산기를 전달하는 촉매 작용을 하는 효소의 큰 계열입니다. [2] 티로신 키나제는 단백질에서 티로신 잔기의 인산화를 촉매합니다. [2] 티로신 잔기의 인산화는 차례로 티로신이 함유된 단백질의 기능에 변화를 일으킵니다. [2]

티로신 잔기에서의 인산화는 효소 활성, 세포내 국소화 및 분자 간의 상호작용과 같은 단백질의 광범위한 특성을 제어합니다. 또한, 티로신 키나제는 세포외 신호가 세포막을 통해 세포질 및 종종 핵으로 전달되는 많은 신호 전달 캐스케이드에서 기능하며, 여기서 유전자 발현이 변형될 수 있다. [3] 마지막으로 돌연변이는 일부 티로신 키나제가 암의 시작 또는 진행에 기여할 수 있는 논스톱 기능 상태인 구성적으로 활성이 되게 할 수 있습니다.

티로신 키나제는 다양한 과정, 경로 및 작용에서 기능하며 신체의 주요 사건을 담당합니다. 수용체 티로신 키나제는 막횡단 신호전달에서 기능하는 반면, 세포 내의 티로신 키나제는 핵으로의 신호 전달에서 기능한다. 핵에서의 Tyrosine kinase 활성은 세포주기 조절과 전사인자의 특성을 포함한다. 이와 같이, 실제로 티로신 키나아제 활성은 유사분열 형성에 관여하거나, 또는 이 과정에서 세포질 내 단백질 및 핵 내 단백질이 티로신 잔기에서 인산화되는 세포 유사분열 유도에 관여한다. [3] 세포 성장과 번식은 어느 정도 티로신 키나아제에 의존할 수 있습니다. Tyrosine kinase 기능은 염색질이 아니라 핵 외피와 DNA를 물리적으로 안정화시키는 역할을 하는 "섬유질 웹"으로 구성된 핵 기질에서 관찰되었습니다. [3] 구체적으로, 핵기질에서 확인된 Src 계열의 키나아제 유형인 Lyn은 세포주기를 조절하는 것으로 보인다. Src 계열 티로신 키나제는 밀접하게 관련되어 있지만 다양한 기능을 보여줍니다. Src family tyrosine kinases의 역할이나 발현은 세포의 성장과 분화 동안 뿐만 아니라 세포의 종류에 따라 크게 달라집니다. [3] Lyn 및 Src 계열 티로신 키나제는 일반적으로 신호 전달 경로에서 기능하는 것으로 알려져 있습니다. [3] Lyn이 세포막에 국한되어 있다는 증거가 있습니다. Lyn은 물리적으로나 기능적으로 다양한 수용체 분자와 연관되어 있습니다. [삼]

세포외 기질과 콜라겐을 합성하고 상처 치유에 관여하는 세포 유형인 섬유아세포는 폴리오마바이러스에 의해 변형된 세포 기질에서 더 높은 티로신 활성을 보유합니다. 또한, 티로신 키나제 활성은 세포 형질전환과 상관관계가 있는 것으로 결정되었습니다. [3] 또한 티로신에 대한 middle-T 항원의 인산화가 세포 성장 또는 번식과 유사한 변화인 세포 형질전환과 관련이 있음이 입증되었습니다. [삼]

기계적 힘과 조절 신호의 전달은 살아있는 유기체의 정상적인 생존에서 매우 기본적입니다. 단백질 티로신 키나아제도 이 작업에서 역할을 합니다. pp125라고 하는 단백질 티로신 키나제는 상기 키나제의 면역형광 국소화에 의해 표시되는 바와 같이 세포 국소 유착의 영향에 있을 가능성이 있습니다. 초점 유착은 기계적 힘과 조절 신호를 전달하는 기능을 하는 거대분자 구조입니다. [5] 과학계에서 pp125는 앞서 언급한 세포 초점 유착에 존재하기 때문에 FAK(초점 유착 키나제)라고도 합니다. 단백질 티로신 키나아제 pp125는 영향을 받지 않은(변환되지 않은) 조류 및 설치류 섬유아세포(섬유아세포 세포는 위에서 자세히 설명됨)에 있는 주요 포스포티로신 함유 단백질 중 하나입니다. [5] 섬유아세포는 동물의 상처 치유 및 세포 구조를 담당하는 세포 유형이며, 자주 또는 가끔 발생하는 비교적 사소하지만 중요한 여러 작업 중 하나입니다. National Biomedical Research Foundation 및 GenBank 데이터베이스와 비교할 때 pp125의 서열 및 구조는 [5] 상당히 독특할 수 있으며, 이는 이것이 단백질 티로신 키나제 패밀리의 새로운 구성원일 수 있음을 의미할 수 있음을 의미합니다. 이 단백질 티로신 키나제는 일부 다른 단백질 티로신 키나제와 비교하여 최대 약 70% 독특하며, 이는 확립된 단백질 티로신 키나제 패밀리의 실제 구성원 사이의 것과는 다른 수치입니다. [5] 또한, 관찰된 아미노산 서열은 그것이 세포질과 연관되어 있음을 간접적으로 의미하며, 이를 세포질 단백질 티로신 키나아제의 큰 그룹 중 하나로 명명하였다. [5] 모노클로날 항체가 그것을 인식하는 것을 관찰했을 때 발견되었다. [5] pp60v-src에 의해 형질전환된 닭 배아 세포의 모노클로날 항체는 7가지 다른 포스포티로신 함유 단백질을 인식합니다. [5] 2A7이라는 단일 클론 항체 중 하나는 pp125를 인식하여 pp125가 실제로 단백질 티로신 키나제라는 생각을 뒷받침합니다. [5]

위에서 자세히 설명한 바와 같이 세포 증식은 티로신 키나제에 부분적으로 의존할 수 있습니다. [3] Tyrosine kinase 기능은 핵기질에서 관찰되었다. 핵 기질에서 처음으로 발견된 키나아제 유형인 Lyn은 티로신 키나아제의 Src 계열의 일부이며 분화하는 칼슘 유발 케르티노사이트의 핵에 포함될 수 있습니다. DNA를 물리적으로 안정화시키는 핵막과 "섬유질 웹" 중 핵 기질에 있는 Lyn은 기질과 결합하여 기능하는 것으로 밝혀졌습니다. 또한 세포주기에 조건부로 나타났다. [3] Lyn 단백질이 핵기질 내에서 전체 티로신 키나아제 활성에 기여하는 바는 알려져 있지 않으나 Lyn이 부분적으로만 추출되었기 때문에 활성의 정확한 측정을 관리할 수 없었습니다. [3] 표시는 Vegesna에 따르면 다음과 같습니다. et al. (1996), Lyn 폴리펩타이드는 핵 기질에서 티로신 키나제 활성과 관련이 있습니다. 추출된 Lyn은 효소적으로 활성화되어 이러한 개념을 뒷받침합니다.

단백질 티로신 키나제의 또 다른 가능하고 가능한 역할은 쥐의 내독소에 의해 유발된 순환 부전 및 기관 기능 장애의 경우, 억제제인 ​​티르포스틴 및 제니스테인의 효과가 단백질 티로신 키나제와 관련되어 있다는 것입니다. [4] 세포막의 수용체가 받은 주변 신호는 세포질로 전달된다. Bae에 따르면 수용체 티로신 키나아제로 인한 막횡단 신호전달 et al. (2009), 예를 들어 SH2 단백질 도메인에 의해 매개되는 상호작용에 크게 의존하며, 실험을 통해 SH2 단백질 도메인 선택성이 티로신 키나제를 포함하는 세포 과정을 매개하는데 기능적이라는 것이 확인되었습니다. 수용체 티로신 키나제는 이 방법에 의해 성장 인자 수용체 신호 전달에 영향을 미칠 수 있습니다. 이것은 보다 기본적인 세포 통신 기능 후생동물 중 하나입니다. [6]

티로신 키나아제 효소가 다른 요인에 의해 영향을 받을 때 주요 변화가 유발되는 경우가 있습니다. 요인 중 하나는 리간드라고 하는 단백질에 가역적으로 결합된 분자입니다. 확실히 전부는 아니지만 다수의 수용체 티로신 키나제는 이러한 리간드 중 하나에 의해 점유되거나 활성화될 때까지 단백질 키나제 활성을 수행하지 않습니다. [2] 더 많은 연구에서 수용체가 엔도솜 내에서 활성 상태로 남아 있음을 나타내지만, 리간드에 의한 세포내이입이 수용체가 비활성화되는 과정의 원인이 되는 사건으로 생각되었습니다. 활성화된 수용체 티로신 키나제 수용체는 짧은 시간에 내재화되고(시스템으로 다시 재순환) 궁극적으로 리소좀으로 전달되어 소화에 참여하는 이화분해산 가수분해효소에 인접하게 됩니다. 내재화된 신호전달 복합체는 다른 수용체 티로신 키나제 시스템에서 다른 역할에 관여하며, 그 특성이 연구되었습니다. [7] 또한 리간드는 가역적 결합에 참여하며 억제제는 비공유적으로 결합합니다(이 억제제가 효소, 효소-기질 복합체 또는 둘 다에 결합하는지 여부에 따라 다른 유형의 억제가 영향을 받음). 관련 과학 연구에 참여하는 일부 사람들에게 특히 관심을 끄는 속성인 다가가는 한 단위에 위치한 여러 리간드가 다른 단위의 여러 일치하는 수용체에 동시에 결합하는 것을 특징으로 하는 현상입니다. 어쨌든 리간드가 파트너에 결합하는 것은 많은 단백질의 기능에 미칠 수 있는 영향으로 인해 명백합니다. [2] 리간드 활성화 수용체 티로신 키나제는 때때로 언급되는 고유한 특성을 보여줍니다. 티로신 수용체 키나아제가 리간드에 결합되면 세포의 세포질에 존재하는 티로신 키나아제에 결합할 수 있습니다. [2]

적혈구 편집

작동 중인 이 트리거 시스템의 예는 적혈구 형성이 조절되는 과정입니다. 포유류는 발달 신호가 생성되는 신장에서 시작하는 이 시스템을 가지고 있습니다. [2] 사이토카인이라고도 하는 발달 신호는 이 경우 에리트로포이에틴입니다. (사이토카인은 조혈 세포 증식 및 분화의 주요 조절자입니다.) 에리트로포이에틴의 활성은 조혈 사이토카인 수용체가 활성화될 때 시작됩니다. 적혈구 조절에서 적혈구생성인자(erythropoietin)는 165개의 아미노산을 포함하는 단백질로 세포질 단백질 키나아제 JAK를 활성화시키는 역할을 한다. [2] 일부 새로운 연구 결과에 따르면 앞서 언급한 사이토카인 수용체가 JAK 티로신 키나제 계열의 구성원과 함께 기능하는 것으로 나타났습니다. 사이토카인 수용체는 JAK 키나제를 활성화합니다. 이것은 세포막에 위치한 여러 신호 단백질의 인산화를 초래합니다. 이것은 결과적으로 리간드 매개 수용체의 자극과 세포내 신호전달 경로 활성화 모두에 영향을 미칩니다. JAK 키나제의 기질은 일부 유전자 반응 등을 매개합니다. [9] 이 과정은 또한 혈구 생성을 매개하는 역할도 합니다. 이 경우 에리트로포이에틴은 해당 원형질막 수용체에 결합하여 수용체를 이량체화한다. [2] 이량체는 결합을 통해 키나제 JAK를 활성화하는 역할을 합니다. [2] 에리트로포이에틴 수용체의 세포질 도메인에 위치한 티로신 잔기는 결과적으로 활성화된 단백질 키나제 JAK에 의해 인산화된다. [2] 전반적으로 이것은 또한 수용체 티로신 키나제가 적혈구 형성을 조절하기 위해 리간드에 의해 활성화되는 방식이기도 합니다.

다른 예

이와 유사한 요인에 의해 영향을 받는 단백질 티로신 키나아제 활성의 추가 사례가 존재합니다. Grb2와 같은 어댑터 단백질은 수용체 단백질 키나제의 영향으로 인산-티로신 잔기에 결합합니다. 이 메커니즘은 단백질-단백질 상호작용을 유발하는 일반적인 메커니즘입니다. [2]

또한 추가 상황을 설명하기 위해 인슐린 관련 인자가 티로신 키나제에 영향을 미치는 것으로 확인되었습니다. 인슐린 수용체 기질은 인슐린의 효과를 조절함으로써 신호 전달 기능을 하는 분자입니다. [2] 많은 수용체 효소는 구조 및 수용체 티로신 키나아제 활성과 밀접한 관련이 있으며, 기본 또는 원형 수용체 효소는 인슐린인 것으로 결정되었습니다. 인슐린 수용체 기질 IRS2 및 IRS3는 각각 수용체 티로신 키나제에 의해 개시되는 경로에서 신호전달 능력을 향상시키는 역할을 하는 독특한 특징적인 조직 기능 및 분포를 갖는다. [2] 활성화된 IRS-1 분자 향상시키다 인슐린이 만들어내는 신호. [2] 대조적으로 인슐린 수용체 시스템은 줄다 엔도솜 신호의 효능. [7]

표피 성장 인자 수용체 시스템은 그 자체로 중간 예로서 사용되어 왔다. 이 경우 일부 신호는 실제 세포 표면에서 생성되지만 다른 신호는 엔도솜 내부에서 나오는 것처럼 보입니다. 이러한 다양한 기능은 리간드 특이적 신호를 생성하는 수단이 될 수 있습니다. [7] 이것은 mRNA 번역 이후의 단백질 변형에 대한 용어인 트래피킹이 수용체 신호 전달 기능에 필수적일 수 있다는 개념을 뒷받침합니다.


구성적으로 활성인 키나아제가 고도로 조절될 수 있습니까? - 생물학

표피 성장 인자 수용체(EGF) 변형 III형(EGFRvIII)은 많은 유형의 인간 종양에서 발견되는 EGF 수용체의 구성적으로 활성이며 자연적으로 발생하는 돌연변이입니다. NIH3T3 섬유아세포에서 과발현될 때, EGFRvIII은 세포 성장을 강화하고 세포자멸사를 감소시켜 형질전환을 유도합니다. 다운스트림 신호 전달 경로의 분석은 세포외 신호 조절 키나아제 활성이 하향 조절되는 것으로 밝혀졌으며, 이는 형질전환을 촉진하는 데 이 경로의 중요성에 대한 의구심을 불러일으키고 있습니다. 우리는 c-Jun N-말단 키나아제(JNK) 경로가 EGFRvIII에 의해 영향을 받는지 여부를 조사했습니다. EGFRvIII을 발현하는 NIH3T3 세포는 정상 EGF 수용체를 과발현하는 세포에는 존재하지 않는 높은 기초 수준의 JNK 활성을 나타내었다. EGF 수용체 또는 포스파티딜이노시톨 3-키나제의 억제제로 EGFRvIII을 과발현하는 세포를 처리하면 JNK 활성이 하향 조절됩니다. 더욱이, JNK 활성의 하향 조절은 형질전환과 관련된 특성의 손실과 관련이 있었고, 이들 세포에서 세포자멸사 촉진에서 JNK 활성에 대한 증거는 없었다. 이러한 발견은 EGFRvIII에 의한 형질전환에서 JNK 경로의 구성적 활성화를 의미한다.


미토겐 활성화 단백질 키나아제/세포외 신호 조절 키나아제 키나아제(MEK) 의존적 전사 프로그램은 아미노산 제한 동안 초기 성장 반응 1(EGR1) 유전자의 활성화를 제어합니다

포유류 세포의 아미노산(AA) 제한은 AA 반응(AAR)이라고 하는 신호 캐스케이드의 집합을 촉발합니다. 인간 HepG2 간세포 암종에서 초기 성장 반응 1(EGR1) 유전자는 AA 박탈 또는 소포체 스트레스에 의해 유도되었습니다. AAR 의존적 EGR1 활성화는 잘 규명된 GCN2-ATF4 경로와 무관하고 대신 MAPK 경로 중 하나인 MEK-ERK 신호전달에 의존하는 것으로 밝혀졌다. ChIP는 EGR1 근위 프로모터 영역에서 구성적으로 결합된 ELK1이 AAR 활성화 후에 인산화되었음을 보여주었다. 증가된 p-ELK1 결합은 EGR1 프로모터에 대한 RNA 중합효소 II의 증가된 신규 모집과 관련이 있었습니다. EGR1 전사는 내인성 MEK 활성이 결여된 HEK293T 세포에서 유도되지 않았지만, HEK293T 세포에서 외인성 구성적으로 활성인 MEK의 과발현은 기저 및 AAR-유도 EGR1 발현을 증가시켰다. 알려진 EGR1 반응성 유전자인 인간 혈관 내피 성장 인자 A(VEGF-A) 유전자의 ChIP 분석은 근위 프로모터 내의 AAR 유도 EGR1 결합의 적당한 증가와 첫 번째 인트론 내의 부위에 대한 고도의 유도성 결합을 밝혀냈습니다. 종합적으로, 이 데이터는 새로운 AA 활성화 MEK-ERK-ELK1 신호 메커니즘을 문서화합니다.

키워드: ATF4 아미노산 아미노산 반응 아스파라긴 합성 효소 유전자 전사 HepG2 세포 간세포 암종 Mitogen-activated protein Kinase (MAPK) 전사.

© 2014 미국 생화학 및 분자 생물학 학회, Inc.


구성적으로 활성인 키나아제가 고도로 조절될 수 있습니까? - 생물학

혈청 및 글루코코르티코이드 조절 키나아제(SGK)는 단백질 키나아제 B(PKB)/Akt 계열과 구조 및 서열 유사성을 나타내는 세린/트레오닌 단백질 키나아제 계열을 형성합니다. 이 두 계열의 주요 차이점은 SGK에 지질 결합 플렉스트린 상동성 도메인이 없다는 것입니다. 플렉스트린 상동성 도메인이 없음에도 불구하고 3개의 인간 동형의 활성화는 PKB와 마찬가지로 성장 인자 및 유사분열원에 의해 유도되는 포스파티딜이노시톨 3'-키나제(PI3K) 경로에 의존합니다. 전장 SGK3에는 단백질을 엔도솜으로 표적화하는 완전한 Phox 상동성(PX) 도메인이 포함되어 있습니다. 기능적 PX 도메인과 PI3K 활성화는 두 조절 부위(Thr-320 및 Ser-486)에서 SGK3의 인산화 및 후속적인 키나제 활성 유도에 필요합니다. PDK1은 Thr-320에서 엔도솜 관련 SGK3을 인산화하는 반면, PDK1이 정상적으로 PKB를 활성화하는 원형질막으로의 SGK3 전환은 SGK3의 PDK1 인산화를 방해합니다. SGK3의 카르복실 말단 소수성 모티프(HM)가 PRK2의 HM으로 교환된 키메라 단백질은 구성적으로 활성입니다. 마지막으로, 우리는 HM이 인산화되면 SGK3 활성화가 PX 도메인 독립적이 된다는 것을 보여줍니다. 종합하면, 이러한 데이터는 PX 도메인에 의해 매개되는 엔도솜에 대한 SGK3의 표적화가 적절한 SGK3 활성화에 필수적임을 나타내며, 이는 아마도 엔도솜, PI3K 의존성 및 스타우로스포린 민감성 HM 키나제와 SGK3의 공동 국소화 때문일 수 있습니다.


재료 및 방법

봄베신 수용체 패밀리의 계통발생학적 분석 및 선택 분석

봄베신 수용체 패밀리 구성원의 엑손과 두 개의 유사 유전자(CCHaR-1 및 CCHaR-2) 및 외부 그룹 유전자(EDNRA)는 기본 설정을 사용하여 아미노산 서열로 번역되고 ClustalX 버전 1.8과 정렬되었습니다[70]. 해당 종 및 유전자는 S1 표에 나와 있습니다. MEGA 6.06[71]의 Maximum Likelihood 방법을 사용하여 아미노산 서열의 다중 정렬을 기반으로 하는 뿌리가 없는 트리 토폴로지를 얻었습니다. 우리는 PAML 버전 4.4의 분기 사이트 모델을 사용하여 관심 대상에 대한 양성 선택을 테스트했습니다. 계통발생학적 분석을 위한 종은 다음과 같다. 호모: 시간. 사피엔스 : NS. 백혈구 무스: 미디엄. 근육 등나무: NS. 노베기쿠스 수스: NS. 크로파 카프라: . 히르쿠스 오비스: 영형. 양자리 개속: . 친숙한 루푸스 펠리스: NS. 고양이 오릭스테로푸스: 영형. 아페르 록소돈타: . 아프리카나 Phascolarctos: NS. 시네레우스 모노델피스: 미디엄. 도메스티카 오리너구리: 영형. 아나티누스 갈루스: NS. 갈루스 아놀리스: NS. 캐롤리넨시스 국화: . 픽타 제노푸스: NS. 열대 지방 레피소스테우스: . 오큘라투스 다니오: NS. 레리오 삭코글로스: NS. 코왈레프스키 아칸타스터: NS. 플랑시 강심성: NS. 자반병 아피스: NS. 멜리페라 나소니아: N. 비트리페니스 초파리: NS. 멜라노가스터 아이데스: NS. 이집트 트리볼륨: NS. 캐스타늄 캄포노투스: . 플로리다누스 파라스테아토다: NS. 미지근한 미주스: 미디엄. 페르시카에 링굴라: . 아나티나 크라소스트레아: . 버지니아 그리고 미즈호펙텐: 미디엄. 예소엔시스.

유전 및 구조 분석

WebLogo는 다중 시퀀스 정렬 내 패턴의 그래픽 표현인 시퀀스 로고를 생성하고 이러한 패턴을 발견하고 분석하는 데 도움을 주기 위해 개발되었습니다[72, 73]. GPCR에서 보존된 사이트/영역을 찾기 위해 WebLogo를 구현했습니다. GPCR의 서열 유사성 및 동일성은 Sequence Manipulation Suite에 의해 계산되었습니다. I-TASSER 알고리즘은 단백질 형태 예측을 위해 개발되었습니다[74, 75]. I-TASSER를 사용하여 GPCR의 구조를 예측했습니다. GPCR 구조 간의 RMSD는 Rosetta 소프트웨어에 의해 계산되었습니다. Discovery Studio는 수용체의 잠재적인 결합 포켓을 예측하기 위한 패키지 모음입니다. RosettaDock은 강체 방향과 측쇄 형태를 모두 최적화하는 몬테카를로 기반 다중 스케일 도킹 알고리즘입니다[41]. 예상되는 가장 큰 가능한 결합 포켓에 따르면, RosettaDock에서 활용하기 위해 단백질 복합체의 초기 형태가 구성되었습니다. Rosetta의 FelxPepDock 모듈은 유연한 펩타이드와 구형 단백질 사이의 복합체에 대한 고해상도 모델을 생성하도록 설계되었습니다[76]. 따라서 Rosetta의 FelxPepDock 모듈을 사용하여 에너지가 가장 낮은 펩타이드-단백질 복합체를 최적화했습니다. 결합 부위는 펩티드-단백질 복합체의 처음 10개의 저에너지 점수 최적화 모델을 기반으로 분석되었습니다. PyMOL은 GPCR의 3차원(3D) 구조를 시각화하기 위한 분자 그래픽 시스템입니다[77].

펩티드 및 BRS3 돌연변이의 생성

리간드 펩타이드의 경우 두 개의 보존 및 공통 펩타이드(GRP-GSHWAVGHLM-NH2 및 NMB-GNLWATGHFM-NH2) 및 mBRS3의 N-말단 펩티드(MSQRQSQSPNQTLISITNDTETSSVVSNDTTHKGWTGDNS-NH2)은 방사성 리간드 결합 분석을 제외한 수용체-리간드 기능 분석을 위해 Biotech Bioengineering(중국 상하이)에서 합성되었습니다. QuikChange II 부위 지정 돌연변이 유발 키트(Agilent Technologies)를 사용하여 점 돌연변이를 도입하여 BRS3 돌연변이를 생성했습니다. 간단히 말해서, 원하는 점 돌연변이를 갖는 중첩 프라이머를 사용하여 야생형 BRS3을 증폭시켰다. 모 플라스미드는 DpnI 효소를 사용하여 분해되었고 새로 합성된 플라스미드는 pcDNA3.1-V5-His 플라스미드로 서브클로닝되기 전에 BRS3 돌연변이체의 PCR 증폭을 위한 주형으로 사용되었습니다.

루시페라제 분석

BRS3의 구성 활성을 감지하기 위해 HEK293 세포를 24웰 플레이트에 접종하고 CRE/NFAT-RE/SRF-RE/SRE 루시퍼라제 리포터 플라스미드(50ng), 다른 종의 BRS3 또는 다른 종의 BRS3 돌연변이로 공동 형질감염했습니다. 24시간 후 용량(10ng/50ng/150ng)에서 세포를 추가로 루시퍼라제 분석 전에 무혈청 배지에서 추가 12시간 동안 인큐베이션했습니다. As for peptide supplementation treatment, HEK293 cells were cotransfected with the CRE/NFAT-RE/SRF-RE/SRE luciferase reporter plasmids (50 ng) and various genes (300 ng) of the bombesin receptor family. After 24 h, cells were further incubated in serum-free media and GRP/NMB peptides (0/10/100/1,000 nM) or the N-terminal peptides of mBRS3 (1,000 nM) with different concentrations for another 12 h. Luciferase activities were determined using luciferase assay kits (Beyotime, Shanghai, China) and normalized to β-galactosidase activity. All experiments were performed at least three times in triplicates. HEK293 cells transfected with pcDNA were used as a blank control in all luciferase experiments, and the fold was calculated compared to blank control.

ERK1/2 phosphorylation

For ERK1/2 phosphorylation, HEK293 cells were seeded in 24-well plates and transfected with GRPR, NMBR, BRS3, mutants of different species’ BRS3, or an empty vector plasmid, pcDNA3.1-V5-His plasmid (300 ng). After 36 h, cells were incubated in serum-free media for another 8 h stimulated with 1,000 nm GRP or NMB for 0, 2, and 5 min or 0, 2, 5, and 10 min homogenized in lysis buffer containing 50 mM Tris-HCl (pH 6.8) and 2% sodium dodecyl sulphate (SDS) with freshly added protease/phosphatase inhibitor cocktail (Cell Signaling Technology, Indianapolis, IN, USA) and subjected to western blot using specific antibodies for ERK1/2 (Cell Signaling Technology, Cat. #9102, 1:2,000) and phosphor-ERK1/2 (Cell Signaling Technology, Cat. #9101, 1:1,000). Each sample with an equal amount of protein was mixed with 6×SDS sample buffer, boiled for 5 min, and separated on 10% SDS-polyacrylamide gel electrophoresis (PAGE) before transferring the proteins onto a PVDF membrane. The membranes were then blocked at room temperature for 1 h with 5% milk powder in Tris-buffered saline-Tween (TBST), followed by subsequent incubation at 4°C overnight in TBST containing the different primary antibodies (1:1,000 dilution). After washing three times (10 min each time) with TBST, the membranes were incubated for 1 h in TBST containing the secondary antibodies (1:2,000 dilution), followed by washing three times (10 min each time) with TBST, prior to detection by chemiluminescence.

Expression pattern of BRS3 receptors and their mutants

HEK293 cells were seeded in 24-well plates, and the expression vector pcDNA3.1-V5-His containing the different BRS3 orthologs or relevant mutants was transiently transfected into HEK 293 cells using Lipofectamine 2000 (Invitrogen) with 300 ng of different species’ BRS3 receptor or mutants. After 48 h, supernatant was removed and cells rinsed twice with PBS, homogenized in lysis buffer, and subjected to western blot analysis using specific Bombesin Receptor Polyclonal Antibody (Thermo Fisher, Cat. #PA5-26484/Lot. #A81B02N, 1:1,000) and actin as a control (Sigma-Aldrich, A5441, 1:5,000).

Intracellular calcium assay

Intracellular calcium was measured using the non-wash calcium assay Fluo8 kit (ab112129, Abcam) according to the manufacturer’s instructions. Briefly, HEK293 cells were seeded in 24-well plates and were transfected with GRPR, NMBR, BRS3, or the empty vector plasmid pcDNA3.1-V5-His (300 ng) and incubated overnight at 37°C with 5% CO2. The next day, the cells were replated into a 96-well assay plate (black plate and clear bottom). After 12 h, growth media were aspirated, and calcium dye was added. Following incubation for 30 min at 37°C and 10 min at room temperature, GRP (10 nM) or NMB (10 nM) was added, and assay plates were placed into a fluorescence kinetic plate reader (Hamamatsu) immediately. The basal fluorescence intensity was recorded 15 times at 1 Hz for 20 s. The results were normalized to the average basal fluorescence intensity in ratio, and the peak response was used for the result calculation. Calcium fold was calculated using no stimulation data as standard value.

Radioligand binding assays

The unlabeled ligand peptides GRP (APLQPGGSPALTKIYPRGSHWAVGHLM) and NMB (YKIKVNPRGNLWATGHFM) were synthesized by [ 125 I]-Tyr 42 -GRP and [ 125 I]-Tyr-NMB (Anhui Guoping Pharmaceutical) at a specific activity of 870 Ci/mmol and 690 Ci/mmol, respectively, and were prepared by the Beijing North Institute of Biotechnology. HEK293 cells were seeded in a 10-cm tissue culture dish at a density of 10 6 cells per dish and grown overnight at 37°C in growth medium. The following morning, 5 μg of different species’ BRS3 plasmids were transfected. After 6 h, the medium was replaced with growth medium. Cells were maintained at 37°C in a 5% CO2 atmosphere and used 48 h later for binding assays. The positive control group included transfected GRPR and NMBR the test group consisted of transfected BRS3 from different species. Then, [ 125 I]-Tyr 42 -GRP and [ 125 I]-Tyr-NMB were used as the ligands to assess affinity to the various receptors. Briefly, 48 h after transient transfection with Lipofectamine, disaggregated transfected cells were incubated for 1 h at 21°C in 250 μl of binding buffer containing 24.5 mM HEPES (pH 7.4), 98 mM NaCl, 6 mM KCl, 2.5 mM KH24, 5 mM sodium pyruvate, 5 mM sodium fumarate, 5 mM sodium glutamate, 2 mM glutamine, 11.5 mM glucose, 0.5 mM CaCl2, 1 mM MgCl2, 0.01% (w/v) soybean trypsin inhibitor, 0.2% (v/v) amino acid mixture, 0.2% (w/v) BSA, and 0.05% (w/v) bacitracin with 50 pM of [ 125 I]-Tyr 42 -GRP (870 Ci/mmol) or 50 pM of [ 125 I]-Tyr-NMB (690 Ci/mmol) in the presence of the indicated concentration of unlabeled peptides. The cell concentration was adjusted to between 0.05 and 4 × 10 6 cells/ml for each receptor such that less than 20% of the total added radioactive ligand was bound during the incubation, and the results were compared to cells transfected with GRPR or NMBR adjusted in concentration to bind a similar amount of ligand. After the incubation, 100 μl aliquots were added to 1.5-ml microfuge tubes, which contained 100 μl of binding buffer to determine the total radioactivity. The bound tracer was separated from unbound tracer by pelleting the cells through the binding buffer by centrifugation at 10,000NS in a Microfuge E (Beckman) for 3 min. The supernatant was aspirated, and the pelleted cells were rinsed twice with a washing buffer that contained 1% (w/v) BSA in PBS. The amount of radioactivity bound to the cells was measured in a Cobra II Gamma counter (Packard Instruments). Binding was expressed as the percentage of total radioactivity that was associated with the cell pellet. All binding values represented saturable binding nonsaturable binding was <15% of the total binding in all experiments. Each point was measured in duplicate, and each experiment was replicated at least four times. Calculation of affinity was performed by determining the IC50 (the GRP or NMB concentration causing half-maximum inhibition of binding), using the curve-fitting program KaleidaGraph (Synergy Software), and the Hill coefficient (nH) was calculated from the displacement curve by using GraphPad Prism [78]. All the experiment data were calculated using 1 pM ligand-treated as 100% control.

The prediction of binding pocket of Gs, G12, and GPCR

Discovery Studio is a suite of packages for simulating macromolecule systems [37]. The largest possible binding pocket of Gs, G12, and GPCR was then predicted by Discovery Studio 3.0 [37]. These predicted pockets were utilized to construct an initial coarse model of the G protein–GPCR complex. The molecular model of GPCR receptors and G protein were predicted by the I-TASSER algorithm. I-TASSER was designed for protein structure modeling by iterative threading assembly simulations [27]. Starting from an amino acid sequence, I-TASSER first generates 3D atomic models from multiple threading alignments and iterative structural assembly simulations. The function of the protein is then inferred by structurally matching the 3D models with other known proteins. The output from a typical server run contains full-length secondary and tertiary structure predictions and functional annotations on ligand-binding sites, Enzyme Commission numbers, and Gene Ontology terms. An estimate of accuracy of the predictions is provided based on the confidence score of the modeling. Previous study revealed the existence of a selectivity barcode (that is, patterns of amino acids) on each of the 16 human G proteins, which is recognized by distinct regions on the approximately 800 human receptors [1]. Therefore, the docking between GPCRs and G proteins was explored based on the known R-G protein co-crystal structures and homology modeling. The docking process between G protein and GPCRs was the same as the docking process between BRS3 receptors and GPR/NMB. The model with the lowest energy was then obtained using Rosetta software (RosettaDock and FelxPepDock module) [38]. All types of noncovalent interactions at the atomic level in a protein structure could be identified by the RING (http://protein.bio.unipd.it/ring/) [40]. Binding sites between proteins in complex were then obtained by RING.

CAMP assay

HEK293 cells were cultured as a monolayer on culture plates to 80%–90% confluency. Cells were harvested and centrifuged twice at 1,000 rpm for 5 min. The amount of cAMP produced was determined with the cAMP ELISA Detection Kit (GenScript). Three thousand cells per well were preincubated for 45 min at 37°C and subsequently at room temperature for 3 h with a range of agonist concentrations. The incubation was stopped by adding detection mix and antibody solution, according to the instructions of the manufacturer. The generated fluorescence intensity was then quantified finally with Synergy H1(BioTek).

GTPgamma35S incorporation assay

Assays were run in 20 mM HEPES, 100 mM NaCl, 8 mM MgCl2, and 10 μg·mL –1 at pH 7.4 in a final volume of 200 μl in 1.5-ml tubes at 25°C. One hundred microliters of membrane preparation (20 μg protein per well) containing 5 μM GDP was added, followed by the addition of 10 μl of buffer agonists being tested and 10 μl of GTPgamma35S to provide a final concentration in the assay of 400 pM. Cell membranes were incubated for 30 min at 25°C with agonists, followed by addition of GTPgamma35S and incubation for an additional 60 min. Preincubation was employed to ensure that agonists were at equilibrium during the labeling period. Then, 35S-labeled membranes were solubilized for 30 min with 0.27% Nonidet P-40, followed by the addition of the desired antibody (10 μl/well) to provide a final dilution of 1/200 and incubation for an additional 60 min. Fifty microliters of suspended anti-IgG-coated SPA beads was added per tube. Tubes were incubated for 3 h and then were centrifuged, and their radioactivity was determined using a Aloka LSC-8000 counter.

통계 분석

Experiments were repeated independently at least three times. Results were analyzed using GraphPad Prism 5. Differences between two groups were compared using two-tailed Student NS 시험. One-way ANOVA was followed by a Fisher’s LSD post hoc test to evaluate the differences among multiple groups. Data are expressed as mean ± SEM. Calculations were done with a standard statistical package (SPSS for Windows, version 21). Statistical significance was defined as a NS value < 0.05 (*) or NS value < 0.01(**) [79].


Can a constitutively active kinase be highly regulated? - 생물학

The Rho GTPases are involved in many signaling pathways and cellular functions, including the organization of the actin cytoskeleton, regulation of transcription, cell motility, and cell division. The p21 (Cdc42/Rac)-activated kinase PAK mediates a number of biological effects downstream of these Rho GTPases (reviewed by [1]). The phosphorylation state of mammalian PAK is highly regulated: upon binding of GTPases, PAK is potently activated by autophosphorylation at multiple sites, although the mechanisms of PAK downregulation are not known. We now report two PP2C-like serine/threonine phosphatases (POPX1 and POPX2) that efficiently inactivate PAK. POPX1 was isolated as a binding partner for the PAK interacting guanine nucleotide exchange factor PIX [2]. The dephosphorylating activity of POPX correlates with an ability to block the in vivo effects of active PAK. Consonant with these effects on PAK, POPX can also inhibit actin stress fiber breakdown and morphological changes driven by active Cdc42 V12 . The association of the POPX phosphatases with PAK complexes may allow PAK to cycle rapidly between active and inactive states it represents a unique regulatory component of the signaling pathways of the PAK kinase family.


각주

The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked 광고 in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

↵ 1 Supported by Grants CA62168 (to D. R. W.), NS10828 (to A. A. and J. V. B.), DK39773 (to J. V. B.) from the NIH the United States Army Medical Research and Materiel Command DAMD17-96-1-6152 (to D. R. W.) the National Foundation for Cancer Research (to D. R. W.) The American Heart Association—Massachusetts Division and CONICIT grants S1-96001340 and G-9700613 (to M. R. and M. S. R.).

↵ 2 To whom requests for reprints should be addressed, D. R. W. at Jake Gittlen Cancer Research Institute, Room C7810, Box H-059, Pennsylvania State University College of Medicine, 500 University Drive, Hershey, PA 17033-2390 or A. A. at Renal Unit, Massachusetts General Hospital-East, 149 13th Street, Charlestown, MA 02129.

↵ 3 The abbreviations used are: MAP, mitogen-activated protein ERK, extracellular signal-regulated kinase MEK, MAP kinase/ERK kinase DS, MEK1-DS DD, MEK1-DD MMP, matrix metalloproteinase.


비디오 보기: კონსტიტუციაში 94-ე მუხლი, შესაძლოა, 12 წლის განმავლობაში დარჩეს (팔월 2022).